PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g095740.1
Common NameMTR_5g095740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 185aa    MW: 19976.3 Da    PI: 6.357
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g095740.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.77.3e-5822117297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+++re+eg
  Medtr5g095740.1  22 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQRFREIEG 115
                      89******************************************************************************************** PP

            NF-YB  96 ek 97 
                      ek
  Medtr5g095740.1 116 EK 117
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-5418125IPR009072Histone-fold
SuperFamilySSF471131.04E-4024130IPR009072Histone-fold
PfamPF008084.9E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.6E-215573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.6E-217492No hitNo description
PRINTSPR006158.6E-2193111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MADSDNESGG APNAGNSELS PREQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYV EPLKIYLQRF REIEGEKTVA  120
ARDKDGVAPS SSSSSVFDYG APPPQVGLIM HHQHQGHVYG SGGFHQVPGG PVYPNAGSNA  180
GRPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B6e-4819112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-4819112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1221650.0AC122165.40 Medicago truncatula clone mth2-32m22, complete sequence.
GenBankBT1413110.0BT141311.1 Medicago truncatula clone JCVI-FLMt-8O17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003617812.21e-137nuclear transcription factor Y protein
SwissprotO233102e-74NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLG7K4Q51e-137G7K4Q5_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA18G08620.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-75nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]